PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00154878001
Common NameGSBRNA2T00154878001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 208aa    MW: 22557.9 Da    PI: 4.9728
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00154878001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA63.91.9e-20130164135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          C++Cg+ kTp+WR gp+g+ktLCnaCG++y++ +l
  GSBRNA2T00154878001 130 CQHCGADKTPQWRAGPSGPKTLCNACGVRYKSGRL 164
                          *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.833124160IPR000679Zinc finger, GATA-type
SMARTSM004017.7E-17124174IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.19E-15126187No hitNo description
Gene3DG3DSA:3.30.50.101.7E-15129162IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.00E-16130178No hitNo description
PfamPF003205.1E-18130164IPR000679Zinc finger, GATA-type
PROSITE patternPS003440130155IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MEAFMEELLN FSVPEEEGGA VLRSPKNIAR RKTGLRQTES FGLLNPDDDL GEVEEEDLEW  60
ISNKDAFPVI ETFVGVLPSE HFSVSSPERE VTEGKQLSPV SVLETSSQNI SITTTTTTSN  120
NSSSGSNISC QHCGADKTPQ WRAGPSGPKT LCNACGVRYK SGRLVPEYRP ANSPTFSPEF  180
HSNSHRKIVE MRKHVVSGDG GGRQDCG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00154878001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010466791.12e-92PREDICTED: GATA transcription factor 1-like isoform X1
SwissprotQ8LAU91e-45GATA1_ARATH; GATA transcription factor 1
TrEMBLA0A078DVS21e-153A0A078DVS2_BRANA; BnaA03g37140D protein
STRINGBra001925.1-P8e-68(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM129872430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.14e-46GATA transcription factor 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]